HORDB

ID: hor002176
Uniprot ID: P01322
Protein name: Insulin-1 A chain
Gene name: Ins1
Organism: Rattus norvegicus (Rat)
Family: Insulin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005158 insulin receptor binding; GO:0005179 hormone activity
GO BP: GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0008286 insulin receptor signaling pathway; GO:0010033 response to organic substance; GO:0031623 receptor internalization; GO:0034097 response to cytokine; GO:0042593 glucose homeostasis; GO:0043434 response to peptide hormone; GO:0050714 positive regulation of protein secretion; GO:0051591 response to cAMP; GO:0071333 cellular response to glucose stimulus; GO:1901701 cellular response to oxygen-containing compound
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005829 cytosol

Sequence: GIVDQCCTSICSLYQLENYCN
Length: 21
Propeptide: MALWMRFLPLLALLVLWEPKPAQAFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVPQLELGGGPEAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
Signal peptide: MALWMRFLPLLALLVLWEPKPAQA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Mechanism: NA
Cross BBB: NA
Target: Insr
Target Unid: P15127
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002176_AF2.pdb

hor002176_ESM.pdb

Mass:	272662	Formula:	C98H153N25O35S4
Absent amino acids:	AFHKMPRW	Common amino acids:	C
pI:	3.55	Basic residues:	0
Polar residues:	12	Hydrophobic residues:	5
Hydrophobicity:	21.43	Boman Index:	-1976
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	88.1
Instability Index:	621.43	Extinction Coefficient cystines:	3230
Absorbance 280nm:	161.5